CPSF4 anticorps (C-Term)

N° du produit ABIN633192

Détail du produit anti-CPSF4 anticorps

Antigène: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPSF4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CPSF4 antibody was raised against the C terminal of CPSF4

Purification: Affinity purified

Immunogène: CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPSF4 Blocking Peptide, catalog no. 33R-8599, is also available for use as a blocking control in assays to test for specificity of this CPSF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPSF4

Antigène: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Autre désignation: CPSF4 (CPSF4 Produits)

Synonymes: anticorps cpsf30, anticorps nar, anticorps neb1, anticorps 30kDa, anticorps C79664, anticorps CPSF30, anticorps NAR, anticorps NEB1, anticorps cleavage and polyadenylation specific factor 4, anticorps cleavage and polyadenylation specific factor 4, 30kDa, anticorps cleavage and polyadenylation specific factor 4 S homeolog, anticorps CPSF4, anticorps Cpsf4, anticorps LOC733099, anticorps LOC100360200, anticorps cpsf4.S, anticorps cpsf4

Sujet: Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

Poids moléculaire: 24 kDa (MW of target protein)