DDX52 anticorps
-
- Antigène Voir toutes DDX52 Anticorps
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX52 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE
- Top Product
- Discover our top product DDX52 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX52 Blocking Peptide, catalog no. 33R-10066, is also available for use as a blocking control in assays to test for specificity of this DDX52 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX52 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
- Autre désignation
- DDX52 (DDX52 Produits)
- Synonymes
- anticorps HUSSY19, anticorps ROK1, anticorps 2700029C06Rik, anticorps Rok1, anticorps DExD-box helicase 52, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, anticorps DEAD-box helicase 52 S homeolog, anticorps DEAD-box helicase 52, anticorps DDX52, anticorps ddx52, anticorps ddx52.S, anticorps Ddx52
- Sujet
- The function of DDX52 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 67 kDa (MW of target protein)
-