SRP68 anticorps (N-Term)

N° du produit ABIN633214

Détail du produit anti-SRP68 anticorps

Antigène: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRP68 est non-conjugé

Application: Western Blotting (WB)

Specificité: SRP68 antibody was raised against the N terminal of SRP68

Purification: Affinity purified

Immunogène: SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRP68 Blocking Peptide, catalog no. 33R-2378, is also available for use as a blocking control in assays to test for specificity of this SRP68 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRP68

Antigène: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Autre désignation: SRP68 (SRP68 Produits)

Synonymes: anticorps 2610024I03Rik, anticorps CG5064, anticorps Dmel\\CG5064, anticorps zgc:92573, anticorps Signal recognition particle 68kDa, anticorps signal recognition particle 68, anticorps Signal recognition particle protein 68, anticorps signal recognition particle 68kDa L homeolog, anticorps GL50803_8916, anticorps SRP68, anticorps Srp68, anticorps srp68, anticorps srp68.L

Sujet: The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.

Poids moléculaire: 71 kDa (MW of target protein)