HNRNPR anticorps (N-Term)

N° du produit ABIN633229

Détail du produit anti-HNRNPR anticorps

Antigène: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPR est non-conjugé

Application: Western Blotting (WB)

Specificité: HNRNPR antibody was raised against the N terminal of HNRNPR

Purification: Affinity purified

Immunogène: HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRNPR Blocking Peptide, catalog no. 33R-1408, is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPR

Antigène: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Autre désignation: HNRNPR (HNRNPR Produits)

Synonymes: anticorps hnrpr, anticorps wu:fb97a09, anticorps wu:fe01h03, anticorps zgc:56523, anticorps HNRPR, anticorps hnRNP R, anticorps hnRNP-R, anticorps 2610003J05Rik, anticorps 2610528B01Rik, anticorps Hnrpr, anticorps heterogeneous nuclear ribonucleoprotein R, anticorps hnrnpr, anticorps HNRNPR, anticorps Hnrnpr

Sujet: HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 71 kDa (MW of target protein)