NXF1 anticorps (N-Term)

N° du produit ABIN633230

Détail du produit anti-NXF1 anticorps

Antigène: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NXF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NXF1 antibody was raised against the N terminal of NXF1

Purification: Affinity purified

Immunogène: NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NXF1 Blocking Peptide, catalog no. 33R-8098, is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NXF1

Antigène: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Autre désignation: NXF1 (NXF1 Produits)

Synonymes: anticorps im:7156527, anticorps wu:fc12d06, anticorps MGC82224, anticorps NXF1, anticorps tap, anticorps mex67, anticorps MEX67, anticorps TAP, anticorps Mex67, anticorps Mvb1, anticorps Tap, anticorps Mex67h, anticorps nuclear RNA export factor 1, anticorps nuclear RNA export factor 1 S homeolog, anticorps Nuclear RNA export factor 1, anticorps nxf1, anticorps nxf1.S, anticorps NXF1, anticorps LOC100113601, anticorps Tsp_03999, anticorps Nxf1, anticorps nxf-1

Sujet: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Poids moléculaire: 68 kDa (MW of target protein)