NXF3 anticorps (N-Term)

N° du produit ABIN633232

Détail du produit anti-NXF3 anticorps

Antigène: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NXF3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NXF3 antibody was raised against the N terminal of NXF3

Purification: Affinity purified

Immunogène: NXF3 antibody was raised using the N terminal of NXF3 corresponding to a region with amino acids SLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NXF3 Blocking Peptide, catalog no. 33R-8615, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NXF3

Antigène: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Autre désignation: NXF3 (NXF3 Produits)

Synonymes: anticorps NXF3, anticorps Gm384, anticorps RGD1564923, anticorps nuclear RNA export factor 3, anticorps NXF3, anticorps LOC523530, anticorps LOC100060140, anticorps LOC100060240, anticorps LOC785244, anticorps Nxf3

Sujet: NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

Poids moléculaire: 60 kDa (MW of target protein)