CSTF2 anticorps (N-Term)
-
- Antigène Voir toutes CSTF2 Anticorps
- CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CSTF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CSTF2 antibody was raised against the N terminal of CSTF2
- Purification
- Affinity purified
- Immunogène
- CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
- Top Product
- Discover our top product CSTF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CSTF2 Blocking Peptide, catalog no. 33R-9471, is also available for use as a blocking control in assays to test for specificity of this CSTF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))
- Autre désignation
- CSTF2 (CSTF2 Produits)
- Synonymes
- anticorps CSTF2, anticorps CstF-64, anticorps fb11e07, anticorps zgc:56346, anticorps zgc:77730, anticorps wu:fb11e07, anticorps 64kDa, anticorps C630034J23Rik, anticorps Cstf64, anticorps CSFT64, anticorps cstF-64, anticorps cstf-64, anticorps cleavage stimulation factor subunit 2, anticorps cleavage stimulation factor, 3' pre-RNA, subunit 2, anticorps cleavage stimulation factor, 3' pre-RNA subunit 2, anticorps CSTF2, anticorps cstf2, anticorps Cstf2, anticorps cstf2.L
- Sujet
- CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.
- Poids moléculaire
- 61 kDa (MW of target protein)
-