SNRPD2 anticorps (Middle Region)
-
- Antigène Voir toutes SNRPD2 Anticorps
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNRPD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SNRPD2 antibody was raised against the middle region of SNRPD2
- Purification
- Affinity purified
- Immunogène
- SNRPD2 antibody was raised using the middle region of SNRPD2 corresponding to a region with amino acids ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG
- Top Product
- Discover our top product SNRPD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNRPD2 Blocking Peptide, catalog no. 33R-2619, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
- Autre désignation
- SNRPD2 (SNRPD2 Produits)
- Synonymes
- anticorps SMD2, anticorps SNRPD1, anticorps Sm-D2, anticorps sm-d2, anticorps smd2, anticorps snrpd1, anticorps 170.t00019, anticorps NCU03778.1, anticorps 1810009A06Rik, anticorps im:6908977, anticorps si:dkey-113g17.2, anticorps zgc:110732, anticorps small nuclear ribonucleoprotein D2 polypeptide, anticorps small nuclear ribonucleoprotein D2 polypeptide L homeolog, anticorps small nuclear ribonucleoprotein Sm D2, anticorps small nuclear ribonucleoprotein sm D2, anticorps small nuclear ribonucleoprotein sm d2, anticorps small nuclear ribonucleoprotein D2, anticorps SNRPD2, anticorps snrpd2, anticorps snrpd2.L, anticorps EHI_108640, anticorps NCU03778, anticorps PVX_002615, anticorps SMP4, anticorps EDI_187160, anticorps LOC100036587, anticorps Snrpd2
- Sujet
- SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 13 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-