RAE1 anticorps

N° du produit ABIN633249

Détail du produit anti-RAE1 anticorps

Antigène: RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAE1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAE1 Blocking Peptide, catalog no. 33R-8290, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAE1

Antigène: RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))

Autre désignation: RAE1 (RAE1 Produits)

Synonymes: anticorps gle2, anticorps mig14, anticorps mnrp41, anticorps mrnp41, anticorps MRNP41, anticorps zgc:56449, anticorps zgc:77723, anticorps 3230401I12Rik, anticorps 41, anticorps D2Ertd342e, anticorps MNRP, anticorps MNRP41, anticorps MIG14, anticorps Mnrp41, anticorps dJ481F12.3, anticorps dJ800J21.1, anticorps ribonucleic acid export 1, anticorps RAE1 RNA export 1 homolog, anticorps ribonucleic acid export 1 L homeolog, anticorps rae1, anticorps LOC664096, anticorps RAE1, anticorps rae1.L, anticorps Rae1

Sujet: RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome