RDBP anticorps (N-Term)

N° du produit ABIN633256

Détail du produit anti-RDBP anticorps

Antigène: RDBP (RD RNA Binding Protein (RDBP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDBP est non-conjugé

Application: Western Blotting (WB)

Specificité: RDBP antibody was raised against the N terminal of RDBP

Purification: Affinity purified

Immunogène: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDBP Blocking Peptide, catalog no. 33R-5514, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDBP

Antigène: RDBP (RD RNA Binding Protein (RDBP))

Autre désignation: RDBP (RDBP Produits)

Synonymes: anticorps CG5994, anticorps Dmel\\CG5994, anticorps NELF, anticorps NELF-E, anticorps Nelf-e, anticorps anon-66Da, anticorps cg5994, anticorps dNelf-E, anticorps D6S45, anticorps RD, anticorps RDBP, anticorps RDP, anticorps Rd, anticorps Rdbp, anticorps D17H6S45, anticorps Negative elongation factor E, anticorps negative elongation factor complex member E, anticorps negative elongation factor complex member E, Rdbp, anticorps Nelf-E, anticorps NELFE, anticorps Nelfe

Sujet: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).

Poids moléculaire: 43 kDa (MW of target protein)