DHX15 anticorps

N° du produit ABIN633263

Détail du produit anti-DHX15 anticorps

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivité: Humain, Souris, Rat, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX15 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX15 Blocking Peptide, catalog no. 33R-10140, is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX15

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Autre désignation: DHX15 (DHX15 Produits)

Synonymes: anticorps DBP1, anticorps DDX15, anticorps HRH2, anticorps PRP43, anticorps PRPF43, anticorps PrPp43p, anticorps im:2639158, anticorps wu:fb38f09, anticorps wu:fk62f05, anticorps DDBDRAFT_0186395, anticorps DDBDRAFT_0233403, anticorps DDB_0186395, anticorps DDB_0233403, anticorps Ddx15, anticorps mDEAH9, anticorps DHX15, anticorps DEAH-box helicase 15, anticorps DEAH (Asp-Glu-Ala-His) box helicase 15, anticorps DEAH-box helicase 15 L homeolog, anticorps DEAD/DEAH box helicase, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 15, anticorps DHX15, anticorps dhx15, anticorps dhx15.L, anticorps Dhx15

Sujet: DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Poids moléculaire: 91 kDa (MW of target protein)