INTS6 anticorps (C-Term)

N° du produit ABIN633264

Détail du produit anti-INTS6 anticorps

Antigène: INTS6 (Integrator Complex Subunit 6 (INTS6))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INTS6 est non-conjugé

Application: Western Blotting (WB)

Specificité: INTS6 antibody was raised against the C terminal of INTS6

Purification: Affinity purified

Immunogène: INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INTS6 Blocking Peptide, catalog no. 33R-3261, is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INTS6

Antigène: INTS6 (Integrator Complex Subunit 6 (INTS6))

Autre désignation: INTS6 (INTS6 Produits)

Synonymes: anticorps DBI-1, anticorps DDX26, anticorps DDX26A, anticorps DICE1, anticorps HDB, anticorps INT6, anticorps Notchl2, anticorps EIF3-P48, anticorps EIF3S6, anticorps eIF3-p46, anticorps 2900075H24Rik, anticorps AI480962, anticorps Ddx26, anticorps Notch2l, anticorps LRRGT00024, anticorps ints6, anticorps zgc:63527, anticorps INTS6, anticorps ints6-b, anticorps Int6-A, anticorps dbi-1, anticorps ddx26, anticorps ddx26a, anticorps dice1, anticorps hdb, anticorps int6, anticorps ints6-a, anticorps notchl2, anticorps integrator complex subunit 6, anticorps eukaryotic translation initiation factor 3 subunit E, anticorps integrator complex subunit 6 like, anticorps integrator complex subunit 6 S homeolog, anticorps integrator complex subunit 6 L homeolog, anticorps INTS6, anticorps EIF3E, anticorps Ints6, anticorps ints6l, anticorps ints6, anticorps ints6.S, anticorps Tsp_09465, anticorps LOC100164318, anticorps ints6.L

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Poids moléculaire: 99 kDa (MW of target protein)