EXOSC3 anticorps (Middle Region)
-
- Antigène Voir toutes EXOSC3 Anticorps
- EXOSC3 (Exosome Component 3 (EXOSC3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOSC3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- EXOSC3 antibody was raised against the middle region of EXOSC3
- Purification
- Affinity purified
- Immunogène
- EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
- Top Product
- Discover our top product EXOSC3 Anticorps primaire
-
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibody
EXOSC3 Reactivité: Humain WB, ELISA, IP, IHC (p) Hôte: Souris Monoclonal 5C3 unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibodyEXOSC3 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 1-275) antibodyEXOSC3 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 176-274) antibodyEXOSC3 Reactivité: Humain ELISA, IP Hôte: Souris Monoclonal 3E5 unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reactivité: Humain, Souris, Chien, Boeuf (Vache), Cobaye, Cheval, Lapin, Porc, Singe, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 81-130) antibodyEXOSC3 Reactivité: Humain, Souris, Chien, Boeuf (Vache), Cobaye, Cheval, Lapin, Porc, Singe, Poulet, Xenopus laevis WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) antibodyEXOSC3 Reactivité: Humain WB, FACS Hôte: Souris Monoclonal 1D6 unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (AA 2-275) antibodyEXOSC3 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 3 (EXOSC3) (C-Term) antibodyEXOSC3 Reactivité: Humain, Souris, Chien, Boeuf (Vache), Cobaye, Cheval, Lapin, Porc, Poisson zèbre (Danio rerio), Singe, Roussette (Chauve-souris), Poulet WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOSC3 Blocking Peptide, catalog no. 33R-9133, is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOSC3 (Exosome Component 3 (EXOSC3))
- Autre désignation
- EXOSC3 (EXOSC3 Produits)
- Synonymes
- anticorps PCH1B, anticorps RP11-3J10.8, anticorps RRP40, anticorps Rrp40p, anticorps bA3J10.7, anticorps hRrp-40, anticorps p10, anticorps 2310005D06Rik, anticorps AI593501, anticorps Rrp40, anticorps im:7140537, anticorps zgc:112345, anticorps exosome component 3, anticorps exosome component 3 L homeolog, anticorps EXOSC3, anticorps exosc3.L, anticorps Exosc3, anticorps exosc3
- Sujet
- EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interactome
-
