SNRPB anticorps (N-Term)

N° du produit ABIN633272

Détail du produit anti-SNRPB anticorps

Antigène: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPB est non-conjugé

Application: Western Blotting (WB)

Specificité: SNRPB antibody was raised against the N terminal of SNRPB

Purification: Affinity purified

Immunogène: SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPB Blocking Peptide, catalog no. 33R-2018, is also available for use as a blocking control in assays to test for specificity of this SNRPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPB

Antigène: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Autre désignation: SNRPB (SNRPB Produits)

Synonymes: anticorps AL024368, anticorps AU018828, anticorps SM-B, anticorps SM11, anticorps SMB, anticorps SNRNP-B, anticorps SNRB', anticorps SNRPB', anticorps Snrpn, anticorps zgc:77315, anticorps cod, anticorps sm-b/b', anticorps smb/b', anticorps smb/smb', anticorps snrnp-b, anticorps snrpb1, anticorps snurf, anticorps DDBDRAFT_0206555, anticorps DDBDRAFT_0233178, anticorps DDB_0206555, anticorps DDB_0233178, anticorps COD, anticorps SNRPB1, anticorps Sm-B/B', anticorps SmB/B', anticorps SmB/SmB', anticorps snRNP-B, anticorps Sm-B', anticorps SmB', anticorps snRNP-B', anticorps snRPB', anticorps small nuclear ribonucleoprotein B, anticorps small nuclear ribonucleoprotein polypeptides B and B1, anticorps small nuclear ribonucleoprotein polypeptide-like, anticorps small nuclear ribonucleoprotein polypeptides B and B1 L homeolog, anticorps mRNA splicing factor, anticorps LSM domain-containing protein, anticorps Snrpb, anticorps SNRPL, anticorps snrpb, anticorps SNRPB, anticorps snrpb.L, anticorps snrpB

Sujet: SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization