SNRPD1 anticorps (N-Term)

N° du produit ABIN633274

Détail du produit anti-SNRPD1 anticorps

Antigène: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPD1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SNRPD1 antibody was raised against the N terminal of SNRPD1

Purification: Affinity purified

Immunogène: SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPD1 Blocking Peptide, catalog no. 33R-6711, is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPD1

Antigène: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Autre désignation: SNRPD1 (SNRPD1 Produits)

Synonymes: anticorps HsT2456, anticorps SMD1, anticorps SNRPD, anticorps Sm-D1, anticorps SNRPD2, anticorps AA407109, anticorps AL023031, anticorps CHUNP6882, anticorps fk26a01, anticorps snprd1, anticorps snrnpd1, anticorps wu:fk26a01, anticorps zgc:86929, anticorps small nuclear ribonucleoprotein D1 polypeptide, anticorps small nuclear ribonucleoprotein D1, anticorps small nuclear ribonucleoprotein D1 polypeptide L homeolog, anticorps SNRPD1, anticorps Snrpd1, anticorps snrpd1, anticorps snrpd1.L

Sujet: SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization