EXOSC2 anticorps (Middle Region)
-
- Antigène Voir toutes EXOSC2 Anticorps
- EXOSC2 (Exosome Component 2 (EXOSC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOSC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXOSC2 antibody was raised against the middle region of EXOSC2
- Purification
- Affinity purified
- Immunogène
- EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG
- Top Product
- Discover our top product EXOSC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOSC2 Blocking Peptide, catalog no. 33R-1154, is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOSC2 (Exosome Component 2 (EXOSC2))
- Autre désignation
- EXOSC2 (EXOSC2 Produits)
- Synonymes
- anticorps EXOSC2, anticorps exosc2, anticorps MGC97533, anticorps RRP4, anticorps Rrp4p, anticorps hRrp4p, anticorps p7, anticorps Rrp4, anticorps fa97b01, anticorps wu:fa97b01, anticorps zgc:110117, anticorps exosome component 2, anticorps exosome component 2 L homeolog, anticorps EXOSC2, anticorps exosc2, anticorps Bm1_33895, anticorps PTRG_00114, anticorps Exosc2, anticorps exosc2.L
- Sujet
- EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-