SRSF3 anticorps (N-Term)
-
- Antigène Voir toutes SRSF3 Anticorps
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRSF3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRS3 antibody was raised against the N terminal of SFRS3
- Purification
- Affinity purified
- Immunogène
- SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
- Top Product
- Discover our top product SRSF3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS3 Blocking Peptide, catalog no. 33R-8935, is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
- Autre désignation
- SFRS3 (SRSF3 Produits)
- Synonymes
- anticorps SFRS3, anticorps SRp20, anticorps AL024116, anticorps Sfrs3, anticorps X16, anticorps sfrs3, anticorps srp20, anticorps SRP20, anticorps si:zc263a23.9, anticorps zgc:86626, anticorps serine and arginine rich splicing factor 3, anticorps serine/arginine-rich splicing factor 3, anticorps serine/arginine-rich splicing factor 3 S homeolog, anticorps serine/arginine-rich splicing factor 3a, anticorps SRSF3, anticorps Srsf3, anticorps srsf3.S, anticorps srsf3a
- Sujet
- SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.
- Poids moléculaire
- 19 kDa (MW of target protein)
-