RTCD1 anticorps (N-Term)

N° du produit ABIN633294

Détail du produit anti-RTCD1 anticorps

Antigène: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RTCD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RTCD1 antibody was raised against the N terminal of RTCD1

Purification: Affinity purified

Immunogène: RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RTCD1 Blocking Peptide, catalog no. 33R-9747, is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RTCD1

Antigène: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Autre désignation: RTCD1 (RTCD1 Produits)

Synonymes: anticorps Dmel\\CG4061, anticorps EG:22E5.3, anticorps RTC1_DROME, anticorps DKFZp469J2025, anticorps cb158, anticorps rtcd1, anticorps sb:cb158, anticorps wu:fc62c03, anticorps zgc:56339, anticorps RTCD1, anticorps RPC, anticorps RTC1, anticorps 2310009A18Rik, anticorps AI450277, anticorps Rtcd1, anticorps RNA 3'-terminal phosphate cyclase, anticorps Rtca, anticorps RTCA, anticorps rtca, anticorps rtca.L

Sujet: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.

Poids moléculaire: 39 kDa (MW of target protein)