JAKMIP1 anticorps (Middle Region)
-
- Antigène Voir toutes JAKMIP1 Anticorps
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp JAKMIP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- JAKMIP1 antibody was raised against the middle region of JAKMIP1
- Purification
- Affinity purified
- Immunogène
- JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
- Top Product
- Discover our top product JAKMIP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
- Autre désignation
- JAKMIP1 (JAKMIP1 Produits)
- Synonymes
- anticorps MGC81051, anticorps Gababrbp, anticorps JAMIP1, anticorps MARLIN1, anticorps 5830437M04Rik, anticorps C330021K24Rik, anticorps Marlin-1, anticorps janus kinase and microtubule interacting protein 1, anticorps janus kinase and microtubule interacting protein 1 L homeolog, anticorps janus kinase and microtubule-interacting protein 1, anticorps Celf_2690, anticorps JAKMIP1, anticorps jakmip1.L, anticorps LOC100070079, anticorps jakmip1, anticorps LOC100432594, anticorps Jakmip1
- Sujet
- JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
- Poids moléculaire
- 97 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-