SEPSECS anticorps (N-Term)
-
- Antigène Voir toutes SEPSECS Anticorps
- SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEPSECS est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SLA/LP antibody was raised against the N terminal of SLA/LP
- Attributs du produit
- Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP
- Purification
- Affinity purified
- Immunogène
- SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
- Top Product
- Discover our top product SEPSECS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))
- Autre désignation
- SLA/LP (SEPSECS Produits)
- Synonymes
- anticorps LP, anticorps PCH2D, anticorps SLA, anticorps SLA/LP, anticorps 9130208G10, anticorps AA986712, anticorps D5Ertd135e, anticorps SecS, anticorps sla/lpl, anticorps zgc:55980, anticorps sepsecs, anticorps Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, anticorps Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase L homeolog, anticorps SEPSECS, anticorps Sepsecs, anticorps sepsecs, anticorps sepsecs.L
- Classe de substances
- Antibody
- Sujet
- SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-