SEPSECS anticorps (N-Term)

N° du produit ABIN633298

Détail du produit anti-SEPSECS anticorps

Antigène: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEPSECS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SLA/LP antibody was raised against the N terminal of SLA/LP

Attributs du produit: Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP

Purification: Affinity purified

Immunogène: SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEPSECS

Antigène: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Autre désignation: SLA/LP (SEPSECS Produits)

Synonymes: anticorps LP, anticorps PCH2D, anticorps SLA, anticorps SLA/LP, anticorps 9130208G10, anticorps AA986712, anticorps D5Ertd135e, anticorps SecS, anticorps sla/lpl, anticorps zgc:55980, anticorps sepsecs, anticorps Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, anticorps Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase L homeolog, anticorps SEPSECS, anticorps Sepsecs, anticorps sepsecs, anticorps sepsecs.L

Classe de substances: Antibody

Sujet: SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome