EIF4H anticorps (C-Term)
-
- Antigène Voir toutes EIF4H Anticorps
- EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF4H est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF4 H antibody was raised against the C terminal of EIF4
- Purification
- Affinity purified
- Immunogène
- EIF4 H antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE
- Top Product
- Discover our top product EIF4H Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF4H Blocking Peptide, catalog no. 33R-9032, is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))
- Autre désignation
- EIF4H (EIF4H Produits)
- Synonymes
- anticorps wscr1, anticorps wbscr1, anticorps WBSCR1, anticorps Wbscr1, anticorps WSCR1, anticorps eIF-4H, anticorps AU018978, anticorps D5Ertd355e, anticorps E430026L18Rik, anticorps Ef4h, anticorps Wscr1, anticorps mKIAA0038, anticorps zgc:77282, anticorps eukaryotic translation initiation factor 4H, anticorps eukaryotic translation initiation factor 4H L homeolog, anticorps eukaryotic translation initiation factor 4h, anticorps transaltion initiation factor, anticorps Eukaryotic translation initiation factor 4H, anticorps eif4h, anticorps eif4h.L, anticorps EIF4H, anticorps Eif4h, anticorps LOC733087, anticorps SJAG_03433, anticorps MGYG_07815, anticorps Tsp_06589, anticorps if4h
- Sujet
- EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-