RBMS2 anticorps (N-Term)

N° du produit ABIN633313

Détail du produit anti-RBMS2 anticorps

Antigène: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBMS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBMS2 antibody was raised against the N terminal of RBMS2

Purification: Affinity purified

Immunogène: RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBMS2 Blocking Peptide, catalog no. 33R-6197, is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBMS2

Antigène: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Autre désignation: RBMS2 (RBMS2 Produits)

Synonymes: anticorps SCR3, anticorps 2610315E04Rik, anticorps Scr3, anticorps zgc:100836, anticorps RBMS2, anticorps RNA binding motif single stranded interacting protein 2, anticorps RNA binding motif, single stranded interacting protein 2, anticorps RNA binding motif, single stranded interacting protein 2b, anticorps RBMS2, anticorps Rbms2, anticorps rbms2b

Sujet: RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

Poids moléculaire: 44 kDa (MW of target protein)