XRN1 anticorps (Middle Region)
-
- Antigène Voir toutes XRN1 Anticorps
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp XRN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- XRN1 antibody was raised against the middle region of XRN1
- Purification
- Affinity purified
- Immunogène
- XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM
- Top Product
- Discover our top product XRN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
XRN1 Blocking Peptide, catalog no. 33R-5282, is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
- Autre désignation
- XRN1 (XRN1 Produits)
- Synonymes
- anticorps wu:fk92c07, anticorps zgc:63635, anticorps SEP1, anticorps Dhm2, anticorps exo, anticorps mXrn1, anticorps RGD1309713, anticorps 5'-3' exoribonuclease 1, anticorps xrn1, anticorps XRN1, anticorps Tsp_05930, anticorps Xrn1
- Sujet
- SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.
- Poids moléculaire
- 194 kDa (MW of target protein)
-