MIF4GD anticorps (N-Term)

N° du produit ABIN633321

Détail du produit anti-MIF4GD anticorps

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MIF4GD est non-conjugé

Application: Western Blotting (WB)

Specificité: MIF4 GD antibody was raised against the N terminal of MIF4 D

Purification: Affinity purified

Immunogène: MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MIF4GD Blocking Peptide, catalog no. 33R-6024, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MIF4GD

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Autre désignation: MIF4GD (MIF4GD Produits)

Synonymes: anticorps AD023, anticorps MIFD, anticorps SLIP1, anticorps 1110014L05Rik, anticorps 2310075G12Rik, anticorps RGD1309685, anticorps MIF4GD, anticorps zgc:64152, anticorps zgc:110826, anticorps ad023, anticorps mif4gd, anticorps mif4gd-a, anticorps mif4gd-b, anticorps mifd, anticorps slip1, anticorps MIF4G domain containing, anticorps MIF4G domain containing a, anticorps MIF4G domain containing b, anticorps MIF4G domain containing L homeolog, anticorps MIF4G domain containing S homeolog, anticorps MIF4GD, anticorps Mif4gd, anticorps mif4gda, anticorps mif4gdb, anticorps mif4gd.L, anticorps mif4gd.S

Sujet: MIF4GD is a protein which contains an MIF4G domain.

Poids moléculaire: 29 kDa (MW of target protein)