BOLL anticorps
-
- Antigène Voir toutes BOLL Anticorps
- BOLL (Bol, Boule-Like (BOLL))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BOLL est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
- Top Product
- Discover our top product BOLL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BOLL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BOLL (Bol, Boule-Like (BOLL))
- Autre désignation
- BOLL (BOLL Produits)
- Synonymes
- anticorps BOULE, anticorps 4930554P13Rik, anticorps 4930597B14Rik, anticorps RGD1559527, anticorps boule homolog, RNA binding protein, anticorps bol, boule-like (Drosophila), anticorps BOLL, anticorps Boll
- Sujet
- This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.
- Poids moléculaire
- 31 kDa (MW of target protein)
-