DHX37 anticorps
-
- Antigène Voir toutes DHX37 Anticorps
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHX37 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
- Top Product
- Discover our top product DHX37 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHX37 Blocking Peptide, catalog no. 33R-7211, is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX37 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
- Autre désignation
- DHX37 (DHX37 Produits)
- Synonymes
- anticorps DDBDRAFT_0187437, anticorps DDBDRAFT_0235265, anticorps DDB_0187437, anticorps DDB_0235265, anticorps im:7151586, anticorps wu:fd11d06, anticorps zgc:158802, anticorps DDX37, anticorps Gm1050, anticorps Gm451, anticorps mKIAA1517, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 37, anticorps DEAD/DEAH box helicase, anticorps DEAH-box helicase 37, anticorps DEAH-box helicase 37 L homeolog, anticorps DHX37, anticorps dhx37, anticorps dhx37.L, anticorps Dhx37
- Sujet
- DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Poids moléculaire
- 129 kDa (MW of target protein)
-