DHX34 anticorps
-
- Antigène Voir toutes DHX34 Anticorps
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHX34 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD
- Top Product
- Discover our top product DHX34 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHX34 Blocking Peptide, catalog no. 33R-9728, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
- Autre désignation
- DHX34 (DHX34 Produits)
- Synonymes
- anticorps DDX34, anticorps HRH1, anticorps 1200013B07Rik, anticorps 1810012L18Rik, anticorps Ddx34, anticorps mKIAA0134, anticorps DExH-box helicase 34, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 34, anticorps DEAH-box helicase 34, anticorps DHX34, anticorps dhx34, anticorps Dhx34
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.
- Poids moléculaire
- 97 kDa (MW of target protein)
-