TROVE2 anticorps (N-Term)

N° du produit ABIN633333

Détail du produit anti-TROVE2 anticorps

Antigène: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TROVE2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TROVE2 antibody was raised against the N terminal of TROVE2

Purification: Affinity purified

Immunogène: TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TROVE2 Blocking Peptide, catalog no. 33R-7498, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TROVE2

Antigène: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Autre désignation: TROVE2 (TROVE2 Produits)

Synonymes: anticorps SSA2, anticorps TROVE2, anticorps ssa2, anticorps ssa2-A, anticorps RO60, anticorps RORNP, anticorps 1810007I17Rik, anticorps A530054J02Rik, anticorps AI646302, anticorps SS-A/Ro, anticorps Ssa, anticorps Ssa2, anticorps TROVE domain family member 2, anticorps TROVE domain family, member 2, anticorps TROVE domain family member 2 L homeolog, anticorps TROVE2, anticorps trove2, anticorps trove2.L, anticorps Trove2

Sujet: TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

Poids moléculaire: 58 kDa (MW of target protein)