EIF3B anticorps (C-Term)
-
- Antigène Voir toutes EIF3B Anticorps
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF3B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF3 S9 antibody was raised against the C terminal of EIF3 9
- Purification
- Affinity purified
- Immunogène
- EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
- Top Product
- Discover our top product EIF3B Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF3S9 Blocking Peptide, catalog no. 33R-10226, is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
- Autre désignation
- EIF3S9 (EIF3B Produits)
- Synonymes
- anticorps EIF3-ETA, anticorps EIF3-P110, anticorps EIF3-P116, anticorps EIF3S9, anticorps PRT1, anticorps AL033316, anticorps AL033334, anticorps AL033369, anticorps AW208965, anticorps D5Wsu45e, anticorps Eif3s9, anticorps eif3-eta, anticorps eif3-p110, anticorps eif3-p116, anticorps eif3s9, anticorps prt1, anticorps ATEIF3B-2, anticorps EIF3B, anticorps EUKARYOTIC TRANSLATION INITIATION FACTOR 3B, anticorps F18A17.30, anticorps F18A17_30, anticorps eukaryotic translation initiation factor 3B-2, anticorps DDBDRAFT_0218512, anticorps DDBDRAFT_0233929, anticorps DDB_0218512, anticorps DDB_0233929, anticorps eIF-3-eta, anticorps eif3b, anticorps wu:fc17c01, anticorps GB10123, anticorps eIF3b, anticorps AO090005000892, anticorps CaO19.6584, anticorps eIF3 p90, anticorps eukaryotic translation initiation factor 3 subunit B, anticorps eukaryotic translation initiation factor 3, subunit B, anticorps eukaryotic translation initiation factor 3B-2, anticorps eukaryotic initiation factor, anticorps RNA recognition motif-containing protein RRM, anticorps eukaryotic translation initiation factor 3b, anticorps eukaryotic translation initiation factor 3 subunit B L homeolog, anticorps eukaryotic translation initiation factor 3, subunit Ba, anticorps eukaryotic translation initiation factor 3 subunit 9, anticorps translation initiation factor eIF-3 subunit 9, anticorps Eukaryotic translation initiation factor 3 subunit B, anticorps translation initiation factor eIF3 subunit b, anticorps EIF3B, anticorps Eif3b, anticorps eif3b, anticorps EIF3B-2, anticorps eIF3s9, anticorps eif3B, anticorps eif3b.L, anticorps eif3ba, anticorps LOC410100, anticorps eIF3-S9, anticorps AOR_1_1564174, anticorps VDBG_02490, anticorps PGTG_13070, anticorps Tsp_02250, anticorps eif-3.B, anticorps PRT1
- Sujet
- EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
- Poids moléculaire
- 90 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-