HNRNPA1L2 anticorps (N-Term)

N° du produit ABIN633345

Détail du produit anti-HNRNPA1L2 anticorps

Antigène: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Épitope: N-Term

Reactivité: Humain, Chien, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA1L2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RP11-78 J21.1 antibody was raised against the N terminal of RP11-78 21.1

Purification: Affinity purified

Immunogène: RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RP11-78J21.1 Blocking Peptide, catalog no. 33R-6454, is also available for use as a blocking control in assays to test for specificity of this RP11-78J21.1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-70 21.1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPA1L2

Antigène: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Abstract: HNRNPA1L2 Produits

Synonymes: anticorps heterogeneous nuclear ribonucleoprotein A1-like 2, anticorps heterogeneous nuclear ribonucleoprotein A1, anticorps HNRNPA1L2, anticorps LOC785761

Sujet: The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)