GRSF1 anticorps (Middle Region)
-
- Antigène Voir toutes GRSF1 Anticorps
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRSF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GRSF1 antibody was raised against the middle region of GRSF1
- Purification
- Affinity purified
- Immunogène
- GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
- Top Product
- Discover our top product GRSF1 Anticorps primaire
-
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) antibody
GRSF1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (Middle Region) antibodyGRSF1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye WB Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) antibodyGRSF1 Reactivité: Humain, Souris ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (AA 87-184) antibodyGRSF1 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (AA 307-333) antibodyGRSF1 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37529 unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) antibodyGRSF1 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (AA 21-80) antibodyGRSF1 Reactivité: Humain, Souris, Boeuf (Vache), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (AA 175-224) antibodyGRSF1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Porc, Chien, Cheval, Lapin, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
anti-G-Rich RNA Sequence Binding Factor 1 (GRSF1) (N-Term) antibodyGRSF1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GRSF1 Blocking Peptide, catalog no. 33R-4139, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
- Autre désignation
- GRSF1 (GRSF1 Produits)
- Synonymes
- anticorps GRSF1, anticorps wu:fb62c04, anticorps zgc:153305, anticorps MGC186196, anticorps B130010H02, anticorps BB232551, anticorps C80280, anticorps D5Wsu31e, anticorps G-rich RNA sequence binding factor 1, anticorps G-rich RNA sequence binding factor 1 S homeolog, anticorps GRSF1, anticorps grsf1, anticorps grsf1.S, anticorps Grsf1
- Sujet
- GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.
- Poids moléculaire
- 53 kDa (MW of target protein)
-
