CTIF/KIAA0427 anticorps (N-Term)
-
- Antigène Voir toutes CTIF/KIAA0427 (CTIF) Anticorps
- CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CTIF/KIAA0427 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA0427 antibody was raised against the N terminal of KIAA0427
- Purification
- Affinity purified
- Immunogène
- KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL
- Top Product
- Discover our top product CTIF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA0427 Blocking Peptide, catalog no. 33R-8789, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0427 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))
- Autre désignation
- KIAA0427 (CTIF Produits)
- Synonymes
- anticorps Gm672, anticorps KIAA0427, anticorps gm672, anticorps kiaa0427, anticorps cap binding complex dependent translation initiation factor, anticorps CBP80/20-dependent translation initiation factor, anticorps similar to Peroxisomal biogenesis factor 19 (Peroxin-19) (Peroxisomal farnesylated protein), anticorps CTIF, anticorps ctif, anticorps Ctif, anticorps LOC679129
- Sujet
- CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons (PTCs) in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay.
- Poids moléculaire
- 67 kDa (MW of target protein)
-