CTIF/KIAA0427 anticorps (N-Term)

N° du produit ABIN633348

Détail du produit anti-CTIF/KIAA0427 anticorps

Antigène: CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTIF/KIAA0427 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA0427 antibody was raised against the N terminal of KIAA0427

Purification: Affinity purified

Immunogène: KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0427 Blocking Peptide, catalog no. 33R-8789, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0427 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTIF/KIAA0427

Antigène: CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))

Autre désignation: KIAA0427 (CTIF Produits)

Synonymes: anticorps Gm672, anticorps KIAA0427, anticorps gm672, anticorps kiaa0427, anticorps cap binding complex dependent translation initiation factor, anticorps CBP80/20-dependent translation initiation factor, anticorps similar to Peroxisomal biogenesis factor 19 (Peroxin-19) (Peroxisomal farnesylated protein), anticorps CTIF, anticorps ctif, anticorps Ctif, anticorps LOC679129

Sujet: CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons (PTCs) in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay.

Poids moléculaire: 67 kDa (MW of target protein)