CELF4 anticorps
-
- Antigène Voir toutes CELF4 Anticorps
- CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CELF4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI
- Top Product
- Discover our top product CELF4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BRUNOL4 Blocking Peptide, catalog no. 33R-7218, is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))
- Autre désignation
- BRUNOL4 (CELF4 Produits)
- Synonymes
- anticorps brunol4, anticorps zgc:92761, anticorps brunol-4, anticorps BRUNOL-4, anticorps BRUNOL4, anticorps A230070D14Rik, anticorps Brul4, anticorps Brunol4, anticorps C130060B05Rik, anticorps CUGBP, Elav-like family member 4, anticorps CUGBP, Elav-like family member 4 L homeolog, anticorps CUGBP Elav-like family member 4, anticorps celf4, anticorps celf4.L, anticorps CELF4, anticorps Celf4, anticorps LOC100732038
- Sujet
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane
-