PCBP3 anticorps

N° du produit ABIN633353

Détail du produit anti-PCBP3 anticorps

Antigène: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCBP3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCBP3 Blocking Peptide, catalog no. 33R-7759, is also available for use as a blocking control in assays to test for specificity of this PCBP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCBP3

Antigène: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Autre désignation: PCBP3 (PCBP3 Produits)

Synonymes: anticorps AlphaCP-3, anticorps ALPHA-CP3, anticorps alpha-CP3, anticorps zgc:109966, anticorps poly(rC) binding protein 3, anticorps Pcbp3, anticorps PCBP3, anticorps pcbp3

Sujet: This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions.

Poids moléculaire: 36 kDa (MW of target protein)