RBM22 anticorps (C-Term)

N° du produit ABIN633355

Détail du produit anti-RBM22 anticorps

Antigène: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM22 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RBM22 antibody was raised against the C terminal of RBM22

Purification: Affinity purified

Immunogène: RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM22 Blocking Peptide, catalog no. 33R-4730, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM22

Antigène: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Autre désignation: RBM22 (RBM22 Produits)

Synonymes: anticorps Cwc2, anticorps ZC3H16, anticorps fSAP47, anticorps 8430430L24Rik, anticorps fb37a01, anticorps zgc:77910, anticorps wu:fb37a01, anticorps wu:fc62e03, anticorps wu:fe05c04, anticorps RBM22, anticorps cg14641, anticorps RNA binding motif protein 22, anticorps RNA binding motif protein 22 S homeolog, anticorps RBM22, anticorps Rbm22, anticorps rbm22, anticorps rbm22.S

Sujet: RBM22 may be involved in pre-mRNA splicing.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus