DHX9 anticorps

N° du produit ABIN633361

Détail du produit anti-DHX9 anticorps

Antigène: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX9 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX9 Blocking Peptide, catalog no. 33R-3397, is also available for use as a blocking control in assays to test for specificity of this DHX9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX9

Antigène: DHX9 (ATP-Dependent RNA Helicase A (DHX9))

Autre désignation: DHX9 (DHX9 Produits)

Synonymes: anticorps DDX9, anticorps LKP, anticorps NDH2, anticorps NDHII, anticorps RHA, anticorps AI326842, anticorps Ddx9, anticorps HEL-5, anticorps mHEL-5, anticorps DExH-box helicase 9, anticorps DEAH-box helicase 9 L homeolog, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 9, anticorps DHX9, anticorps dhx9.L, anticorps Dhx9

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.

Poids moléculaire: 141 kDa (MW of target protein)