DDX42 anticorps

N° du produit ABIN633362

Détail du produit anti-DDX42 anticorps

Antigène: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX42 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX42

Antigène: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Autre désignation: DDX42 (DDX42 Produits)

Synonymes: anticorps im:7148194, anticorps si:dkey-15n1.10, anticorps zgc:111815, anticorps DDX42P, anticorps RHELP, anticorps RNAHP, anticorps SF3b125, anticorps 1810047H21Rik, anticorps AW319508, anticorps AW556242, anticorps B430002H05Rik, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 42, anticorps DEAD-box helicase 42, anticorps DEAD-box helicase 42 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, anticorps ddx42, anticorps DDX42, anticorps Ddx42, anticorps ddx42.L

Sujet: DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Poids moléculaire: 103 kDa (MW of target protein)