DHX30 anticorps

N° du produit ABIN633367

Détail du produit anti-DHX30 anticorps

Antigène: DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX30 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX30 Blocking Peptide, catalog no. 33R-1048, is also available for use as a blocking control in assays to test for specificity of this DHX30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX30

Antigène: DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))

Autre désignation: DHX30 (DHX30 Produits)

Synonymes: anticorps DHX30, anticorps dhx30, anticorps DDX30, anticorps RETCOR, anticorps 2810477H02Rik, anticorps C130058C04Rik, anticorps Ddx30, anticorps HELG, anticorps Ret-CoR, anticorps DExH-box helicase 30, anticorps DEAH (Asp-Glu-Ala-His) box helicase 30, anticorps DEAH-box helicase 30, anticorps DEAH-box helicase 30 S homeolog, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 30, anticorps DHX30, anticorps dhx30, anticorps dhx30.S, anticorps Dhx30

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.

Poids moléculaire: 129 kDa (MW of target protein)

Pathways: Chromatin Binding