DDX27 anticorps
-
- Antigène Voir toutes DDX27 Anticorps
- DDX27 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 27 (DDX27))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX27 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRRQKALGKNRSADFNP
- Top Product
- Discover our top product DDX27 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX27 Blocking Peptide, catalog no. 33R-2044, is also available for use as a blocking control in assays to test for specificity of this DDX27 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX27 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX27 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 27 (DDX27))
- Autre désignation
- DDX27 (DDX27 Produits)
- Synonymes
- anticorps cb843, anticorps DDX27, anticorps MGC114699, anticorps rhlp, anticorps rrp3p, anticorps pp3241, anticorps hspc259, anticorps DRS1, anticorps Drs1p, anticorps PP3241, anticorps RHLP, anticorps dJ686N3.1, anticorps C86129, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 27, anticorps DEAD-box helicase 27, anticorps DEAD-box helicase 27 L homeolog, anticorps ddx27, anticorps DDX27, anticorps ddx27.L, anticorps Ddx27
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX27 is a DEAD box protein, the function of which has not been determined.
- Poids moléculaire
- 90 kDa (MW of target protein)
-