DHX32 anticorps
-
- Antigène Voir toutes DHX32 Anticorps
- DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHX32 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR
- Top Product
- Discover our top product DHX32 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHX32 Blocking Peptide, catalog no. 33R-2347, is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))
- Autre désignation
- DHX32 (DHX32 Produits)
- Synonymes
- anticorps DDX32, anticorps DHLP1, anticorps 3110079L04Rik, anticorps 4732469F02Rik, anticorps AA408140, anticorps Ddx32, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 32, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 32b, anticorps DEAH-box helicase 32 (putative), anticorps DEAH-box helicase 32 (putative) L homeolog, anticorps DHX32, anticorps dhx32b, anticorps Dhx32, anticorps dhx32.L
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.
- Poids moléculaire
- 84 kDa (MW of target protein)
-