DHX35 anticorps

N° du produit ABIN633370

Détail du produit anti-DHX35 anticorps

Antigène: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX35 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX35 Blocking Peptide, catalog no. 33R-5605, is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX35

Antigène: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Autre désignation: DHX35 (DHX35 Produits)

Synonymes: anticorps MGC146350, anticorps C20orf15, anticorps DDX35, anticorps KAIA0875, anticorps 1200009D07Rik, anticorps Ddx35, anticorps probable ATP-dependent RNA helicase DHX35, anticorps DEAH-box helicase 35, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 35, anticorps LOC413147, anticorps DHX35, anticorps dhx35, anticorps LOC100633419, anticorps Dhx35

Sujet: DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.

Poids moléculaire: 79 kDa (MW of target protein)