MRPL24 anticorps (N-Term)

N° du produit ABIN633373

Détail du produit anti-MRPL24 anticorps

Antigène: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL24 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL24 antibody was raised against the N terminal of MRPL24

Purification: Affinity purified

Immunogène: MRPL24 antibody was raised using the N terminal of MRPL24 corresponding to a region with amino acids RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL24 Blocking Peptide, catalog no. 33R-8157, is also available for use as a blocking control in assays to test for specificity of this MRPL24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL24

Antigène: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Autre désignation: MRPL24 (MRPL24 Produits)

Synonymes: anticorps L24mt, anticorps MRP-L18, anticorps MRP-L24, anticorps CG8849, anticorps Dmel\\CG8849, anticorps L24, anticorps RpL24, anticorps 2010005E08Rik, anticorps 2810470K06Rik, anticorps 6720473G22Rik, anticorps AA407670, anticorps rpl24, anticorps rpl24-A, anticorps GB10626, anticorps zgc:92702, anticorps l24mt, anticorps mrp-l18, anticorps mrp-l24, anticorps mitochondrial ribosomal protein L24, anticorps mitochondrial ribosomal protein L24 L homeolog, anticorps probable 39S ribosomal protein L24, mitochondrial, anticorps mitochondrial 54S ribosomal protein YmL24/YmL14, anticorps mitochondrial ribosomal protein subunit L28 (predicted), anticorps Putative mitochondrial ribosomal protein L24, anticorps MRPL24, anticorps mRpL24, anticorps Mrpl24, anticorps mrpl24, anticorps mrpl24.L, anticorps LOC408675, anticorps CAALFM_C203950WA

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24).

Poids moléculaire: 25 kDa (MW of target protein)