RG9MTD1 anticorps

N° du produit ABIN633378

Détail du produit anti-RG9MTD1 anticorps

Antigène: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RG9MTD1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RG9MTD1 Blocking Peptide, catalog no. 33R-6162, is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RG9MTD1

Antigène: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Autre désignation: RG9MTD1 (RG9MTD1 Produits)

Synonymes: anticorps RG9MTD1, anticorps rg9mtd1, anticorps wu:fb53e06, anticorps zgc:103570, anticorps HNYA, anticorps MRPP1, anticorps Rg9mtd1, anticorps 1300018J16Rik, anticorps D16Ertd454e, anticorps Rnmtd1, anticorps tRNA methyltransferase 10C, mitochondrial RNase P subunit, anticorps tRNA methyltransferase 10C, mitochondrial RNase P subunit L homeolog, anticorps tRNA methyltransferase 10C, anticorps TRMT10C, anticorps trmt10c, anticorps trmt10c.L, anticorps Trmt10c

Sujet: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.

Poids moléculaire: 47 kDa (MW of target protein)