KHSRP anticorps (Middle Region)
-
- Antigène Voir toutes KHSRP Anticorps
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KHSRP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KHSRP antibody was raised against the middle region of KHSRP
- Purification
- Affinity purified
- Immunogène
- KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
- Top Product
- Discover our top product KHSRP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
- Autre désignation
- KHSRP (KHSRP Produits)
- Synonymes
- anticorps FBP2, anticorps FUBP2, anticorps KSRP, anticorps 6330409F21Rik, anticorps Fbp2, anticorps Fubp2, anticorps Ksrp, anticorps Marta1, anticorps KHSRP, anticorps VgRBP71, anticorps fbp2, anticorps ksrp, anticorps fubp2, anticorps fc94c12, anticorps wu:fb25b12, anticorps wu:fc10e10, anticorps wu:fc94c12, anticorps zgc:163038, anticorps khsrp-b, anticorps KH-type splicing regulatory protein, anticorps KH-type splicing regulatory protein L homeolog, anticorps KH-type splicing regulatory protein S homeolog, anticorps KHSRP, anticorps Khsrp, anticorps khsrp.L, anticorps khsrp, anticorps khsrp.S
- Sujet
- KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).
- Poids moléculaire
- 73 kDa (MW of target protein)
-