MGC70863 anticorps (N-Term)

N° du produit ABIN633386

Détail du produit anti-MGC70863 anticorps

Antigène: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Specificité: MGC70863 antibody was raised against the N terminal of MGC70863

Purification: Affinity purified

Immunogène: MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC70863 Blocking Peptide, catalog no. 33R-6469, is also available for use as a blocking control in assays to test for specificity of this MGC70863 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70863 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MGC70863

Antigène: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Autre désignation: MGC70863 (RPL23AP82 Produits)

Synonymes: anticorps MGC70863, anticorps RPL23A_43_1761, anticorps ribosomal protein L23a pseudogene 82, anticorps RPL23AP82

Sujet: The function of MGC70863 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 14 kDa (MW of target protein)