C6orf201 anticorps (N-Term)

N° du produit ABIN633387

Détail du produit anti-C6orf201 anticorps

Antigène: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C6orf201 est non-conjugé

Application: Western Blotting (WB)

Specificité: C6 ORF201 antibody was raised against the N terminal Of C6 rf201

Purification: Affinity purified

Immunogène: C6 ORF201 antibody was raised using the N terminal Of C6 rf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF201 Blocking Peptide, catalog no. 33R-7072, is also available for use as a blocking control in assays to test for specificity of this C6ORF201 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF201 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C6orf201

Antigène: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Autre désignation: C6ORF201 (C6orf201 Produits)

Synonymes: anticorps dJ1013A10.5, anticorps chromosome 6 open reading frame 201, anticorps C6orf201

Sujet: The specific function of C6orf201 is not yet known.

Poids moléculaire: 14 kDa (MW of target protein)