U2AF1 anticorps (N-Term)

N° du produit ABIN633390

Détail du produit anti-U2AF1 anticorps

Antigène: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp U2AF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: U2 AF1 antibody was raised against the N terminal of U2 F1

Purification: Affinity purified

Immunogène: U2 AF1 antibody was raised using the N terminal of U2 F1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

U2AF1 Blocking Peptide, catalog no. 33R-5649, is also available for use as a blocking control in assays to test for specificity of this U2AF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 F1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur U2AF1

Antigène: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Autre désignation: U2AF1 (U2AF1 Produits)

Synonymes: anticorps DDBDRAFT_0218665, anticorps DDBDRAFT_0233354, anticorps DDB_0218665, anticorps DDB_0233354, anticorps 2010107D16Rik, anticorps 35kDa, anticorps FP793, anticorps RN, anticorps RNU2AF1, anticorps U2AF35, anticorps U2AFBP, anticorps CHUNP6860, anticorps zgc:111896, anticorps U2 small nuclear RNA auxiliary factor 1, anticorps CCHC-type zinc finger-containing protein, anticorps splicing factor U2AF 35 kDa subunit, anticorps U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 1, anticorps U2 small nuclear RNA auxiliary factor 1 S homeolog, anticorps U2AF1, anticorps u2af1, anticorps LOC737227, anticorps U2af1, anticorps u2af1.S

Sujet: This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site.

Poids moléculaire: 28 kDa (MW of target protein)