SF3A1 anticorps (N-Term)

N° du produit ABIN633401

Détail du produit anti-SF3A1 anticorps

Antigène: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SF3 A1 antibody was raised against the N terminal of SF3 1

Purification: Affinity purified

Immunogène: SF3 A1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3A1 Blocking Peptide, catalog no. 33R-8124, is also available for use as a blocking control in assays to test for specificity of this SF3A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3A1

Antigène: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Autre désignation: SF3A1 (SF3A1 Produits)

Synonymes: anticorps Dmel\\CG16941, anticorps SF3a1, anticorps SF3a120, anticorps DDBDRAFT_0168938, anticorps DDBDRAFT_0233180, anticorps DDB_0168938, anticorps DDB_0233180, anticorps 1200014H24Rik, anticorps 5930416L09Rik, anticorps AI159724, anticorps si:dz150f13.2, anticorps wu:fc38e01, anticorps wu:fc50a11, anticorps wu:fj37c05, anticorps zgc:65786, anticorps PRP21, anticorps PRPF21, anticorps SAP114, anticorps SF3A120, anticorps CG16941 gene product from transcript CG16941-RA, anticorps SWAP/Surp domain-containing protein, anticorps splicing factor 3a, subunit 1, anticorps splicing factor 3a subunit 1, anticorps CG16941, anticorps sf3a1, anticorps spl1, anticorps Sf3a1, anticorps SF3A1

Sujet: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization