RBM4 anticorps (C-Term)
-
- Antigène Voir toutes RBM4 Anticorps
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBM4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM4 antibody was raised against the C terminal of RBM4
- Purification
- Affinity purified
- Immunogène
- RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
- Top Product
- Discover our top product RBM4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM4 Blocking Peptide, catalog no. 33R-5330, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
- Autre désignation
- RBM4 (RBM4 Produits)
- Synonymes
- anticorps rbm4, anticorps rna-bp4, anticorps wu:fc31f07, anticorps wu:fc57h11, anticorps zgc:56302, anticorps LARK, anticorps RBM4A, anticorps ZCCHC21, anticorps ZCRB3A, anticorps 4921506I22Rik, anticorps Lark1, anticorps Mlark, anticorps Rbm4a, anticorps lark, anticorps Rbm4, anticorps RNA binding motif protein 4.1, anticorps RNA binding motif protein 4, anticorps RNA-binding protein 14, anticorps RNA-binding protein lark, anticorps rbm4.1, anticorps RBM4, anticorps LOC610648, anticorps Rbm4, anticorps LARK
- Sujet
- RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Photoperiodism
-