RPS7 anticorps (N-Term)

N° du produit ABIN633403

Détail du produit anti-RPS7 anticorps

Antigène: RPS7 (Ribosomal Protein S7 (RPS7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS7 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS7 antibody was raised against the N terminal of RPS7

Purification: Affinity purified

Immunogène: RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS7 Blocking Peptide, catalog no. 33R-6006, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS7

Antigène: RPS7 (Ribosomal Protein S7 (RPS7))

Autre désignation: RPS7 (RPS7 Produits)

Synonymes: anticorps CG1883, anticorps Dmel\\CG1883, anticorps DBA8, anticorps S7, anticorps Mtu, anticorps Rps7A, anticorps zgc:73216, anticorps dba8, anticorps rpS8B, anticorps rpS8A, anticorps Ribosomal protein S7, anticorps 30S ribosomal protein S7, anticorps 40S ribosomal protein S7, anticorps ribosomal protein S7, anticorps ribosomal protein S7 S homeolog, anticorps ribosomal protein S8, anticorps RpS7, anticorps rps7, anticorps rps-7, anticorps RPS7, anticorps Rps7, anticorps rps7.S

Sujet: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Tube Formation